CJC-1295 No DAC
Growth Hormone Secretagogues
£30.00per vial
Awaiting batch
This vial is sealed for the protection of health and hygiene. Under regulation 28(1)(e) of the Consumer Contracts (Information, Cancellation and Additional Charges) Regulations 2013, the 14-day right to cancel is lost for this item once that seal is broken. While the seal is intact the right applies in full.
CJC-1295 No DAC cannot be listed to research users in Australia, Canada, Japan, Mexico, New Zealand, Norway, Russian Federation, Saudi Arabia, Singapore, South Korea, Switzerland, United Arab Emirates. Verify local eligibility before ordering.
CJC-1295 No DAC is a research peptide listed in the UK for in-vitro laboratory use only. It is not a medicine and it is not for human or veterinary use. This page is the CJC-1295 No DAC listing for Protocol Peptides UK.
CJC-1295 No DAC is a modified 29-amino-acid analogue of growth hormone-releasing hormone, studied at the GHRH receptor. Without the Drug Affinity Complex modification it does not bind serum albumin, so laboratory work uses it to examine short-duration receptor activity against long-acting GHRH analogues.
Also known as Modified GRF (1-29), Mod GRF 1-29, CJC-1295 without DAC.
For laboratory research only. Not for human consumption. No medical claims. This product is not intended to diagnose, treat, cure, or prevent any disease.
- UK DISPATCH
- TRACKED SHIPPING
- COA ON RELEASE
- SECURE PAYMENT
Compound details
CJC-1295 No DAC is a modified 29-amino-acid analogue of growth hormone-releasing hormone, studied at the GHRH receptor. Without the Drug Affinity Complex modification it does not bind serum albumin, so laboratory work uses it to examine short-duration receptor activity against long-acting GHRH analogues.
CJC-1295 No DAC, also referenced in the literature as modified GRF (1-29), is a tetrasubstituted analogue of the first 29 amino acids of growth hormone-releasing hormone. The four substitutions at positions 2, 8, 15, and 27 are made to resist enzymatic cleavage by dipeptidyl peptidase-4, which degrades native GHRH rapidly. It is studied in controlled laboratory settings for its binding at the GHRH receptor and for the intracellular cascade that follows.
- Molecular weight
- 3367.9 g/mol
- Sequence
- YA(D-Ala)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
- Presentation
- Sealed 3ml vial
Molecular weight source: Computed from the published tetrasubstituted GRF (1-29) sequence. Method validated against PubChem CID 16132413 (sermorelin, 3357.9), which the same calculation reproduces exactly. PubChem carries no entry for the No DAC analogue.. View the PubChem record
CJC-1295 No DAC, also referenced in the literature as modified GRF (1-29), is a tetrasubstituted analogue of the first 29 amino acids of growth hormone-releasing hormone. The four substitutions at positions 2, 8, 15, and 27 are made to resist enzymatic cleavage by dipeptidyl peptidase-4, which degrades native GHRH rapidly. It is studied in controlled laboratory settings for its binding at the GHRH receptor and for the intracellular cascade that follows.
The defining research variable is the absence of the Drug Affinity Complex. The DAC-modified form carries a maleimide group that conjugates to serum albumin and extends circulating duration substantially. Without it, CJC-1295 No DAC is examined for short-duration, pulsatile receptor activity, which makes it the comparator compound in study designs that isolate signalling duration as the variable rather than receptor affinity.
Preclinical investigations examine CJC-1295 No DAC in hypothalamic-pituitary axis models, cyclic-AMP second-messenger frameworks, and receptor-binding characterisation. It is catalogued here as a reference compound for laboratory research. No therapeutic, diagnostic, or clinical conclusion is drawn from any study referenced above, and none should be inferred.
CJC-1295 No DAC is listed in a sealed 3ml vial, at 5mg and 10mg.When a batch is released, it is independently analysed before it is listed. Purity is measured by high-performance liquid chromatography. Identity is confirmed by mass spectrometry, which is the check that distinguishes the No DAC form from the DAC-modified analogue by molecular weight. Those are the two analytical methods used, and no other method is claimed.
When a batch is released, the batch number on the vial resolves to the public Certificate of Analysis for that batch, reporting the compound, the lot reference, the HPLC result, the mass-spectrometry result, the analysis date. The document is published before the batch enters the catalogue. Specimen documents on this site are for demonstration only and are not genuine laboratory reports.
When a batch is released, it is independently analysed by HPLC and mass spectrometry before it is listed, and the Certificate of Analysis for that batch is published in full, including the measured purity figure for that batch.
CJC-1295 No DAC
CJ5603Specimen record. Not a genuine laboratory report.
| PARAMETER | METHOD | RESULT |
|---|---|---|
| Purity | HPLC | 98.3% |
| Identity | Mass spectrometry | Consistent with expected mass |
HPLC
Purity by chromatography
ON RELEASE
MASS SPECTROMETRY
Identity confirmation
ON RELEASE
PUBLIC COA
Each released batch number resolves to its Certificate of Analysis
COMMITTED
Research Use Only
CJC-1295 No DAC is catalogued strictly for in-vitro laboratory research. It is not for human consumption, veterinary use, or therapeutic, diagnostic or clinical application. It is not supplied as a medicinal product and it is not licensed by the MHRA.
Not a Medical Product
None of the compounds listed on this site are medicinal products, nor should they be marketed, described or used as such. No medical claims are made about CJC-1295 No DAC. Nothing on this page is medical, veterinary or scientific advice, and no guidance on preparation, administration or quantity is provided or will be provided on request.
Compliance and Responsibility
The research user is responsible for ensuring compliance with all laws and regulations governing the receipt, handling, storage, use and disposal of research chemicals in their jurisdiction, and for applying appropriate control measures under the Control of Substances Hazardous to Health Regulations 2002 or the equivalent local regime.
Analytical Scope
When analytical results are published for CJC-1295 No DAC, they relate solely to the batch identified on the Certificate of Analysis. Two methods are used: high-performance liquid chromatography and mass spectrometry. No other analysis is performed or implied. Results for one batch do not warrant any other batch. Specimen documents are for demonstration only and are not genuine laboratory reports.
Jurisdiction Notice
CJC-1295 No DAC cannot be listed to research users in the following jurisdictions: Australia, Canada, Japan, Mexico, New Zealand, Norway, Russian Federation, Saudi Arabia, Singapore, South Korea, Switzerland, United Arab Emirates. It is the research user's responsibility to verify local eligibility before placing an order. Where an order is placed for a jurisdiction in which the compound cannot be listed, the order will be cancelled and refunded in full.
Every released batch has a document.
The Certificate of Analysis for a batch is published when that batch is released. Your batch number then resolves to the report. Specimen documents on this site are for demonstration only.
For laboratory research only. Not for human consumption. No medical claims.
